DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Vax1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_033527.1 Gene:Vax1 / 22326 MGIID:1277163 Length:338 Species:Mus musculus


Alignment Length:318 Identity:79/318 - (24%)
Similarity:112/318 - (35%) Gaps:120/318 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 GEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGG------KDSQG-----------NGSSSNS 317
            |:.||.....::::::...|.:...:||...|..|.      |:.||           |.|.|||
Mouse     3 GKPDKMDVRCHSDTEAARVSKNAHKESREIKGAEGSLPAAFLKEPQGAFSGSGASEDCNKSKSNS 67

  Fly   318 -------------------------------KSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQ 351
                                           :.:|.||:||:|||..||.||...:|:...||::
Mouse    68 SADPDYCRRILVRDAKGSIREIILPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTE 132

  Fly   352 IATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQ 416
            :|..|.|||.|||:||||||.|.|:           ..|..|..:.||.     ...|..|..:.
Mouse   133 LARQLNLSETQVKVWFQNRRTKQKK-----------DQGKDSELRSVVS-----ETAATCSVLRL 181

  Fly   417 LEKMCLSGPK--PDLRKKLSAEAIG-----------GFEKFSGSTNAS----------------- 451
            ||:..|..|.  |.|....:..|:|           |....:||..|:                 
Mouse   182 LEQGRLLSPPGLPALLPPCATGALGSALRGPSLPALGAGAAAGSAAAAAAAAAATAPGPAGAASQ 246

  Fly   452 -------SPSGGPVGLGVGVGVGVGVG------------LG------VSTPLSLARSI 484
                   :|..||.|.| |:..|....            ||      .|.||::|.|:
Mouse   247 HQPAVGGAPGPGPAGPG-GLHAGAPTASHGLFSLPVPSLLGSVASRLSSAPLTMAGSL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/50 (56%)
Vax1NP_033527.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 16/65 (25%)
Homeobox 103..156 CDD:306543 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..269 6/30 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..338
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.