Sequence 1: | NP_477146.1 | Gene: | unpg / 35942 | FlyBaseID: | FBgn0015561 | Length: | 485 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_033527.1 | Gene: | Vax1 / 22326 | MGIID: | 1277163 | Length: | 338 | Species: | Mus musculus |
Alignment Length: | 318 | Identity: | 79/318 - (24%) |
---|---|---|---|
Similarity: | 112/318 - (35%) | Gaps: | 120/318 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 270 GEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGG------KDSQG-----------NGSSSNS 317
Fly 318 -------------------------------KSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQ 351
Fly 352 IATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQ 416
Fly 417 LEKMCLSGPK--PDLRKKLSAEAIG-----------GFEKFSGSTNAS----------------- 451
Fly 452 -------SPSGGPVGLGVGVGVGVGVG------------LG------VSTPLSLARSI 484 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
unpg | NP_477146.1 | Homeobox | 324..375 | CDD:278475 | 28/50 (56%) |
Vax1 | NP_033527.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..69 | 16/65 (25%) | |
Homeobox | 103..156 | CDD:306543 | 29/52 (56%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 239..269 | 6/30 (20%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 318..338 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |