DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and GSX1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_663632.1 Gene:GSX1 / 219409 HGNCID:20374 Length:264 Species:Homo sapiens


Alignment Length:273 Identity:77/273 - (28%)
Similarity:100/273 - (36%) Gaps:87/273 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 EKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHM-------A 199
            ||:.|...|.||....:|...|..|::|.                   :.|||...:       .
Human    17 EKKAPEGSPPPLFPYAVPPPHALHGLSPG-------------------ACHARKAGLLCVCPLCV 62

  Fly   200 AAGRMHEDQANPGMAQLQEPTPP-----------QAHSSPAKSGSHSPMEPALDVGMDEDFECSG 253
            .|.::|.....|.:..|:...||           :.||:.:...:|.|...|....:.:......
Human    63 TASQLHGPPGPPALPLLKASFPPFGSQYCHAPLGRQHSAVSPGVAHGPAAAAAAAALYQTSYPLP 127

  Fly   254 DSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNS- 317
            |          ||.::                  |...:                    ||||. 
Human   128 D----------PRQFH------------------CISVD--------------------SSSNQL 144

  Fly   318 -KSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGL 381
             .|:|.||||||.|||||||||.:..|||...|.:|||.|.|||.||||||||||.|.|:...|.
Human   145 PSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGS 209

  Fly   382 TSHGLGRNGTTSG 394
            ...|.|..|...|
Human   210 NHRGGGGGGAGGG 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 36/50 (72%)
GSX1NP_663632.1 SNAG domain. /evidence=ECO:0000250 1..20 2/2 (100%)
Homeobox 151..204 CDD:395001 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..264 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.