DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Tlx2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_033418.1 Gene:Tlx2 / 21909 MGIID:1350935 Length:284 Species:Mus musculus


Alignment Length:305 Identity:80/305 - (26%)
Similarity:112/305 - (36%) Gaps:78/305 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 MAAAGRMHEDQANPGMAQ-LQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISL 261
            :||....|.:..:.|:.| |..|.||.....|.:||.......|...|    |..:.......||
Mouse     6 LAAHHLPHHEPISFGIDQILSGPEPPGGGLGPGQSGQSHGESAAFSSG----FHGASGYAPAGSL 66

  Fly   262 TMSPRNYN-GEMDKSRNGAYTNSDSEDCSDDEGAQSRHEG-GGMGG----------------KDS 308
            ...||... |.....|..|:........|....|.....| ||.||                ||.
Mouse    67 ASLPRGSGVGPGGVIRVPAHRPLPVPPPSGAAPAVPGPSGLGGAGGLAGLTFPWMDSGRRFAKDR 131

  Fly   309 QGNGSSSNSKSRR---------------RRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKL 358
            .....|..|.:||               .||:|:..|:|||||.|..:|||:..||:.:|.:|::
Mouse   132 LTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRM 196

  Fly   359 SEVQVKIWFQNRRAKWKRVKA---GLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKM 420
            ::.|||.||||||.||:|..|   ....|..||            :.:|:.:.|:          
Mouse   197 TDAQVKTWFQNRRTKWRRQTAEEREAERHRAGR------------LLLHLQQDAL---------- 239

  Fly   421 CLSGPKPDLRKKL----------SAEAIGGFEKFSGSTNASSPSG 455
                |:| ||..|          |..|:...:.::.....:|.||
Mouse   240 ----PRP-LRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSG 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 26/50 (52%)
Tlx2NP_033418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..52 10/31 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..104 4/25 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..166 6/25 (24%)
Homeobox 160..213 CDD:306543 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.