DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxc10

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_034592.2 Gene:Hoxc10 / 209448 MGIID:96192 Length:342 Species:Mus musculus


Alignment Length:335 Identity:86/335 - (25%)
Similarity:126/335 - (37%) Gaps:84/335 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LSARAMVASSALGLTQFPLYNPWLHGYFAQNHERLTHLIAGG----CYLPSSPAGHPAAQQPQAQ 126
            ||.|....|..|.|..:|.|              |:.|.:.|    .|....|.|.|.:.     
Mouse    53 LSKRDEGGSPNLALNTYPSY--------------LSQLDSWGDPKAAYRLEQPVGRPLSS----- 98

  Fly   127 AQPQPPPPHPPT---------HALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMN 182
                  ..:||:         ::.||:........|.:..||.:.......|....||...    
Mouse    99 ------CSYPPSVKEENVCCMYSAEKRAKSGPEAALYSHPLPESCLGEHEVPVPSYYRASP---- 153

  Fly   183 QDYVHSLSVHARLQHMAAAGRMH---EDQA--NPGMAQLQEPTPPQAHSSP--AKSGSHSPMEPA 240
                 |.|...:..|.|.|....   |.:|  ||....|:.|......|.|  .||.|.:|    
Mouse   154 -----SYSALDKTPHCAGANEFEAPFEQRASLNPRTEHLESPQLGGKVSFPETPKSDSQTP---- 209

  Fly   241 LDVGMDEDFECSGDSCSDISLTMS---PRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGG 302
                          |.::|....|   |:....|.:|.|  |.|...|.|.||:|..:.      
Mouse   210 --------------SPNEIKTEQSLAGPKASPSESEKER--AKTADSSPDTSDNEAKEE------ 252

  Fly   303 MGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWF 367
            :..:::.||..::.| .|::|..:|..|.||||:||....||:...|.:|:.::.|::.||||||
Mouse   253 IKAENTTGNWLTAKS-GRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKTINLTDRQVKIWF 316

  Fly   368 QNRRAKWKRV 377
            ||||.|.|::
Mouse   317 QNRRMKLKKM 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/50 (48%)
Hoxc10NP_034592.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..271 26/111 (23%)
Homeobox 271..324 CDD:278475 25/52 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.