DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Nkx1-2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_033149.1 Gene:Nkx1-2 / 20231 MGIID:104806 Length:305 Species:Mus musculus


Alignment Length:204 Identity:66/204 - (32%)
Similarity:92/204 - (45%) Gaps:48/204 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 EDFECSGDSCS--DISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGA-------QSRHEGG- 301
            |:.|...|:||  .|....:|......:|.......:.::.|:.::|.|.       |..|||. 
Mouse    51 EEVEAGQDACSGNPIGSQETPDAVGRGIDPGSPVEGSEAEEEEEAEDAGRAHQPERWQGVHEGSP 115

  Fly   302 -----GMGGKDSQGNG------------------SSSNSKSRRRRTAFTSEQLLELEREFHAKKY 343
                 .:|.::|...|                  .||.:|.||.|||||.|||:.||.:|.|.:|
Mouse   116 EARAVAVGTEESGAEGLPASPGSPGSPRPRRRRAESSCAKPRRARTAFTYEQLVALENKFRATRY 180

  Fly   344 LSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR--------VKA-------GLTSHGLGRNGTTS 393
            ||:.||..:|.||.|:|.||||||||||.|||:        |:|       |......|..|:.:
Mouse   181 LSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGADGAVQAGGGAPQPGTPGAVAGGGGSAT 245

  Fly   394 GTKIVVPIP 402
            |:....|:|
Mouse   246 GSSPGPPVP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/50 (64%)
Nkx1-2NP_033149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..158 21/106 (20%)
Homeobox 160..212 CDD:278475 33/51 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..257 11/45 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.