Sequence 1: | NP_477146.1 | Gene: | unpg / 35942 | FlyBaseID: | FBgn0015561 | Length: | 485 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006497869.1 | Gene: | Prrx2 / 20204 | MGIID: | 98218 | Length: | 259 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 55/202 - (27%) |
---|---|---|---|
Similarity: | 77/202 - (38%) | Gaps: | 61/202 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 199 AAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTM 263
Fly 264 SPRNYNGEMD---KSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKD---------SQGNGSSSN 316
Fly 317 SKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQV------------KIWFQN 369
Fly 370 RRAKWKR 376 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
unpg | NP_477146.1 | Homeobox | 324..375 | CDD:278475 | 24/62 (39%) |
Prrx2 | XP_006497869.1 | Homeobox | 103..167 | CDD:365835 | 24/63 (38%) |
OAR | 232..249 | CDD:367680 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |