DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and EMX2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_004089.1 Gene:EMX2 / 2018 HGNCID:3341 Length:252 Species:Homo sapiens


Alignment Length:416 Identity:93/416 - (22%)
Similarity:126/416 - (30%) Gaps:192/416 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KPFPKP-FSIESLIANQTPATATPPSPPEERDQEQEAEQEQELSARAMVASSALGLTQFPLYNPW 88
            :|.||. |:||||:|..:|..|:....|                    :..:||........||:
Human     3 QPAPKRCFTIESLVAKDSPLPASRSEDP--------------------IRPAALSYANSSPINPF 47

  Fly    89 LHGYFAQNHERLTHLIAGGCYLPSSPAGHPAAQQPQ---AQAQPQPPPPHPPTHALEKQLPPTLP 150
            |:|:         |..|      ::.||......|.   |:|...||.|..|.|    .:||.  
Human    48 LNGF---------HSAA------AAAAGRGVYSNPDLVFAEAVSHPPNPAVPVH----PVPPP-- 91

  Fly   151 HPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQ 215
                                                |:|:.|                       
Human    92 ------------------------------------HALAAH----------------------- 97

  Fly   216 LQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKS----- 275
               |.|          .||||                           .|...:.:.|.|     
Human    98 ---PLP----------SSHSP---------------------------HPLFASQQRDPSTFYPW 122

  Fly   276 --RNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNS---------KSRRRRTAFTSE 329
              ....|.                       |...|||.:|..|         |.:|.||||:..
Human   123 LIHRYRYL-----------------------GHRFQGNDTSPESFLLHNALARKPKRIRTAFSPS 164

  Fly   330 QLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSG 394
            |||.||..|....|:...||.|:|.||.|:|.|||:||||||.|:||.|  |...|........|
Human   165 QLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQK--LEEEGSDSQQKKKG 227

  Fly   395 TKIVVPIPVHVNRFAVRSQHQQLEKM 420
            |.       |:||:.:.::....|::
Human   228 TH-------HINRWRIATKQASPEEI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/50 (56%)
EMX2NP_004089.1 Homeobox 158..211 CDD:395001 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..252 9/44 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.