DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and unc-42

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001263845.1 Gene:unc-42 / 192081 WormBaseID:WBGene00006778 Length:279 Species:Caenorhabditis elegans


Alignment Length:154 Identity:47/154 - (30%)
Similarity:68/154 - (44%) Gaps:31/154 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 EPALDVGMD-EDFECSGDSCSD-ISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEG 300
            |...|:|:. .||.....|..| :|.::.|.:     |.|.:||:....:|..           |
 Worm    20 EKVKDLGVSLHDFTAYYPSSLDTVSASLRPIS-----DPSSDGAFKKIKTEGL-----------G 68

  Fly   301 GGMGGKDSQG------------NGSSSNSKSRRR-RTAFTSEQLLELEREFHAKKYLSLTERSQI 352
            |.:.|....|            ...|....|||| ||.||.|||.||:..|....|..:..|.::
 Worm    69 GSVFGSSIAGVTNTPARLCSLERPESERLNSRRRHRTTFTQEQLQELDAAFQKSHYPDIYVREEL 133

  Fly   353 ATSLKLSEVQVKIWFQNRRAKWKR 376
            |...||:|.::::||||||||.::
 Worm   134 ARITKLNEARIQVWFQNRRAKHRK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 23/50 (46%)
unc-42NP_001263845.1 Homeobox 103..157 CDD:365835 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.