DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and ceh-16

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001379631.1 Gene:ceh-16 / 191618 WormBaseID:WBGene00000439 Length:187 Species:Caenorhabditis elegans


Alignment Length:206 Identity:63/206 - (30%)
Similarity:91/206 - (44%) Gaps:45/206 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 PTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNS 283
            |.|....|:||.|.                        |.||.|.:..|....:..|...|:..|
 Worm    16 PCPSPTISTPATSP------------------------SSISPTFASPNGTPNIASSMYPAWVFS 56

  Fly   284 DSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRR-RTAFTSEQLLELEREFHAKKYLSLT 347
            ..  .||...|..||.    ..:..:..|||.:|:..:| |||||.:||..|:.||...:||:..
 Worm    57 TR--YSDRPSAGPRHR----KSRKRESTGSSGSSEEEKRPRTAFTGDQLDRLKTEFRESRYLTEK 115

  Fly   348 ERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRS 412
            .|.::|..|.|:|.|:||||||:|||.|:     ::..:.|:..:|    |.|.| | |..::..
 Worm   116 RRQELAHELGLNESQIKIWFQNKRAKLKK-----STSSVPRDRCSS----VTPNP-H-NHPSIHG 169

  Fly   413 QHQ---QLEKM 420
            .:|   ||.|:
 Worm   170 GYQLMAQLAKV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 26/50 (52%)
ceh-16NP_001379631.1 Homeobox 90..144 CDD:395001 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.