DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Nkx2-6

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_035050.2 Gene:Nkx2-6 / 18092 MGIID:97351 Length:289 Species:Mus musculus


Alignment Length:279 Identity:71/279 - (25%)
Similarity:111/279 - (39%) Gaps:71/279 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 QAHSSPAK---------SGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNG 278
            :.|.:|.|         ||.....:.|..|    .|.|:.::..::.     .|..|| .::..|
Mouse    33 ELHRNPVKPRYLRMNQESGWFESSDRAQAV----PFRCTWETVLEMG-----SNPVGE-PQTPPG 87

  Fly   279 AYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRR-RTAFTSEQLLELEREFHAKK 342
            ..:...:.:...|.|.      |.:.|...:|...|:.::.:|: |..|:..|:|.|||.|..::
Mouse    88 TISRLGARNPMTDRGV------GNLSGDMRRGGPVSTRTRPQRKSRVLFSQAQVLALERRFKQQR 146

  Fly   343 YLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAG----LTSHGLGRNGTTSGTKIVVPIPV 403
            ||:..||..:|::|:|:..||||||||||.|.|..:..    |..|.|      :..::.||:  
Mouse   147 YLTAPEREHLASALQLTSTQVKIWFQNRRYKSKSQRQDQTLELAGHPL------APRRVAVPV-- 203

  Fly   404 HVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIGGFEKFSGSTNASSP---SGGPVGLGVGVG 465
                            :.|.| ||.|...::|        |.|...|:||   .||..|......
Mouse   204 ----------------LVLDG-KPCLDPDVAA--------FLGPYKATSPYSCFGGYAGTPYDAS 243

  Fly   466 -----VGVGVGLGVSTPLS 479
                 .....|.|..|||:
Mouse   244 YASRCTSASAGPGPLTPLA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/50 (50%)
Nkx2-6NP_035050.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..125 10/61 (16%)
Homeobox 126..179 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..289 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.