DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and mab-5

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_498695.1 Gene:mab-5 / 176091 WormBaseID:WBGene00003102 Length:200 Species:Caenorhabditis elegans


Alignment Length:218 Identity:64/218 - (29%)
Similarity:86/218 - (39%) Gaps:77/218 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 AAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSS 227
            |||..|..:|   :..||.|..|:::      ::||.|||.| ::.:||...     .|.||.| 
 Worm    38 AAAAAAANNL---KTYELYNHTYMNN------MKHMLAAGWM-DNSSNPFAY-----NPLQATS- 86

  Fly   228 PAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDE 292
             |..|......||                  ||..:.|                           
 Worm    87 -ANFGETRTSMPA------------------ISQPVFP--------------------------- 105

  Fly   293 GAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLK 357
               ....||..||            :|:|.|..::..|.||||:|||..|||:...|.:|:.:|.
 Worm   106 ---WMKMGGAKGG------------ESKRTRQTYSRSQTLELEKEFHYHKYLTRKRRQEISETLH 155

  Fly   358 LSEVQVKIWFQNRRAKWKRVKAG 380
            |:|.||||||||||.|.|:...|
 Worm   156 LTERQVKIWFQNRRMKHKKEAKG 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/50 (54%)
mab-5NP_498695.1 Homeobox 120..173 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.