DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and DLX2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_004396.1 Gene:DLX2 / 1746 HGNCID:2915 Length:328 Species:Homo sapiens


Alignment Length:320 Identity:85/320 - (26%)
Similarity:114/320 - (35%) Gaps:100/320 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 MHEDQANPGMAQLQEPTPPQ------AHSSPAKSGSHSPME-PALDVGMDED------------- 248
            ||..|........|...||.      ..:|.:.|..|.|.| |.|.|....|             
Human    12 MHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQQHPAGG 76

  Fly   249 ---------------FECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTN------SDSEDCSDDE 292
                           ::.||       |...|.:.....|.....|||:      |.|...::.|
Human    77 GGGGGSPYAHMGSYQYQASG-------LNNVPYSAKSSYDLGYTAAYTSYAPYGTSSSPANNEPE 134

  Fly   293 GAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLK 357
            ......|...:.||.         .|.|:.||.::|.||..|:|.|...:||:|.||:::|.||.
Human   135 KEDLEPEIRIVNGKP---------KKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLG 190

  Fly   358 LSEVQVKIWFQNRRAKWKRV-KAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMC 421
            |::.||||||||||:|:|:: |:|                 .:|...|....|        ...|
Human   191 LTQTQVKIWFQNRRSKFKKMWKSG-----------------EIPSEQHPGASA--------SPPC 230

  Fly   422 LSGPKPDLRKKLSAEAIGGFEKFSGSTNASSPSGGPVGLGVGVGVGVGVGLGVSTPLSLA 481
            .|.|       :||.|...|    |.....:..|||     |.| |.|.|...|:|.|.|
Human   231 ASPP-------VSAPASWDF----GVPQRMAGGGGP-----GSG-GSGAGSSGSSPSSAA 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/50 (54%)
DLX2NP_004396.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..81 13/64 (20%)
DLL_N 51..132 CDD:289198 15/87 (17%)
Homeobox 155..208 CDD:278475 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..270 22/100 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.