DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and unc-4

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_496138.1 Gene:unc-4 / 174544 WormBaseID:WBGene00006744 Length:252 Species:Caenorhabditis elegans


Alignment Length:210 Identity:59/210 - (28%)
Similarity:94/210 - (44%) Gaps:23/210 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 ALDVGMDEDFECSGDSCSDI------SLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRH 298
            ||...:|.:.:...|..:|.      |:.::|.:.:.....|.||..|:|..:..|.|:.....:
 Worm     4 ALHACVDAEPKIINDIWADFWKSQINSVLLNPSDGSETYLASDNGKSTSSREQSTSPDDDNLLMN 68

  Fly   299 EGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQV 363
            |..|:..:|....|.|: :|.||.||.|:..||.|||..|.|..|..:..|..:|..|.|.|.:|
 Worm    69 EDDGIALEDDNDTGESA-AKRRRTRTNFSGWQLEELESAFEASHYPDVFMREALAMRLDLLESRV 132

  Fly   364 KIWFQNRRAKWKRVKAGLTSHGLGRNGTTS---------GTKIVVPIPVHVNRFAVRSQHQQLEK 419
            ::|||||||||::.:.       .|||::.         .||.:...|..::.....|:..:..:
 Worm   133 QVWFQNRRAKWRKREQ-------NRNGSSEIKKDDGEQMETKALPTFPFSIDSILAVSRVPRGRR 190

  Fly   420 MCLSGPKPDLRKKLS 434
            .....|:....|.||
 Worm   191 PNAKYPRVQACKNLS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/50 (48%)
unc-4NP_496138.1 COG5576 <79..186 CDD:227863 38/114 (33%)
Homeobox 91..144 CDD:278475 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.