DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment unpg and lin-11

DIOPT Version :9

Sequence 1:	NP_477146.1	Gene:	unpg / 35942	FlyBaseID:	FBgn0015561	Length:	485	Species:	Drosophila melanogaster
Sequence 2:	NP_492696.1	Gene:	lin-11 / 172893	WormBaseID:	WBGene00003000	Length:	405	Species:	Caenorhabditis elegans

Alignment Length:	135	Identity:	45/135 - (33%)
Similarity:	65/135 - (48%)	Gaps:	15/135 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   249 FECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSE----DCSDDEGAQSRHEGGGMGGKDSQ 309
            |.|..| ....:.|.:|.:.:..:.   ||:..|||.|    |..|:.|..   :|.|..|||
Worm   176 FVCQSD-FQTATKTSTPTSIHRPVS---NGSECNSDVEEDNVDACDEVGLD---DGEGDCGKD-- 231

  Fly   310 GNGSSSNSKSRR-RRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAK 373
             |...|||..|| .||...::||..|:..|.|....:...|.|:|....|:...:::||||||:|
Worm   232 -NSDDSNSAKRRGPRTTIKAKQLETLKNAFAATPKPTRHIREQLAAETGLNMRVIQVWFQNRRSK 295

  Fly   374 WKRVK 378
            .:|:|
Worm   296 ERRMK 300

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
unpg	NP_477146.1	Homeobox	324..375	CDD:278475	17/50 (34%)
lin-11	NP_492696.1	LIM	68..123	CDD:278823
		LIM2_Lhx1_Lhx5	127..182	CDD:188761	3/6 (50%)
		Homeobox	244..297	CDD:278475	18/52 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910