DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and ceh-17

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_491393.1 Gene:ceh-17 / 172059 WormBaseID:WBGene00000440 Length:237 Species:Caenorhabditis elegans


Alignment Length:210 Identity:57/210 - (27%)
Similarity:83/210 - (39%) Gaps:55/210 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 ANPGMAQLQEPTPPQAHSSPAKSGSHSPME---------------PALDVGMDEDFECSGDSCSD 258
            ::..:||.....|..|.|:...|..::|..               .||....:.....:|:|.|.
 Worm    10 SSSAVAQQSGDVPTTAPSAVTNSFFYTPQSHNIYHQYATPYLQSGRALTTAHNTSSSSAGNSTSS 74

  Fly   259 ISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSR-HEGGGMGGKDSQGNGSSS------- 315
            .|   |..||       ||   |..||.....:.|.|.: ::...:.|.|:....||:       
 Worm    75 SS---SSSNY-------RN---TTHDSLQAFFNTGLQYQLYQKSQLIGSDTIQRTSSNVLNGLPR 126

  Fly   316 -------------------NSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEV 361
                               ..|.||.||.|||.||.||||.|....|..:..|.:||..:.|:|.
 Worm   127 SSLVGALCSTGGAPLNPAERRKQRRIRTTFTSGQLKELERSFCETHYPDIYTREEIAMRIDLTEA 191

  Fly   362 QVKIWFQNRRAKWKR 376
            :|::||||||||:::
 Worm   192 RVQVWFQNRRAKYRK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 26/50 (52%)
ceh-17NP_491393.1 DLL_N 20..112 CDD:403572 22/104 (21%)
Homeobox 153..206 CDD:395001 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.