DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and GSX2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_573574.2 Gene:GSX2 / 170825 HGNCID:24959 Length:304 Species:Homo sapiens


Alignment Length:312 Identity:91/312 - (29%)
Similarity:116/312 - (37%) Gaps:92/312 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 AQPQP--PPPHP-PTHALEKQLPPTLPHPLDTRFLPFNPAAA-GVAPTDLSYRRLAELMNQDYVH 187
            ::|.|  |.||| |...:...:||.|...:.....|...:.| .|.|          |....::|
Human    16 SRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGCPSRKSGAFCVCP----------LCVTSHLH 70

  Fly   188 SL--SVHARLQH-------------MAAAGRM----HEDQANPGMAQL--------QEPTPPQAH 225
            |.  ||.|....             ..|||.:    .:..:.||.||.        ....|||.|
Human    71 SSRGSVGAGSGGAGAGVTGAGGSGVAGAAGALPLLKGQFSSAPGDAQFCPRVNHAHHHHHPPQHH 135

  Fly   226 SSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRN---------YNGEMDKSRNGAYT 281
            ..     .|.|.:|    |.......:..:.:..:....|::         || ..|..|....|
Human   136 HH-----HHQPQQP----GSAAAAAAAAAAAAAAAALGHPQHHAPVCTATTYN-VADPRRFHCLT 190

  Fly   282 NSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSL 346
                                 |||.|     :|.....:|.||||||.|||||||||.:..|||.
Human   191 ---------------------MGGSD-----ASQVPNGKRMRTAFTSTQLLELEREFSSNMYLSR 229

  Fly   347 TERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGTKIV 398
            ..|.:|||.|.|||.||||||||||.|.|:     ...|..|| :.:|.|.|
Human   230 LRRIEIATYLNLSEKQVKIWFQNRRVKHKK-----EGKGTQRN-SHAGCKCV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 36/50 (72%)
GSX2NP_573574.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..151 10/43 (23%)
Homeobox 206..258 CDD:306543 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..304
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.