DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxc8

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_034596.1 Gene:Hoxc8 / 15426 MGIID:96198 Length:242 Species:Mus musculus


Alignment Length:174 Identity:47/174 - (27%)
Similarity:68/174 - (39%) Gaps:51/174 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 HSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRN--YNGEMDKS-------RNGAY 280
            |.:...|.|.....|.       ...|.||:.........||.  |..:.:.|       ::.|.
Mouse    62 HGTSGISNSGYQQNPC-------SLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSAN 119

  Fly   281 TNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKS-------------RRRRTAFTSEQLL 332
            |||                      .:.||:.:.::|.|             |..|..::..|.|
Mouse   120 TNS----------------------SEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTL 162

  Fly   333 ELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
            |||:||....||:...|.:::.:|.|:|.||||||||||.|||:
Mouse   163 ELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/50 (48%)
Hoxc8NP_034596.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..154 9/61 (15%)
Antp-type hexapeptide 138..143 0/4 (0%)
Homeobox 153..206 CDD:395001 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..242 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.