DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxb3

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus


Alignment Length:403 Identity:102/403 - (25%)
Similarity:141/403 - (34%) Gaps:126/403 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 PPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQH 197
            ||.||..|                                     |..:..||..|......|.:
Mouse    32 PPQPPFQA-------------------------------------ATHLEGDYQRSACSLQSLGN 59

  Fly   198 MAAAGRMHEDQAN---PGMAQLQEPTPPQA----------------HSSPAKSGSHSPMEPALDV 243
            .|...:..|...:   ||:|....|.||.:                ...|:|||..         
Mouse    60 AAPHAKSKELNGSCMRPGLAPEPLPAPPGSPPPSAAPTSTTSNSNNGGGPSKSGPP--------- 115

  Fly   244 GMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDS----EDCSDDEGAQSRHEGGGMG 304
                  :|...|.|.::..:.|     .|.:||..:...:.|    |.|....|......|||.|
Mouse   116 ------KCGAGSNSTLTKQIFP-----WMKESRQTSKLKNSSPGTAEGCGGGGGGGGGGGGGGGG 169

  Fly   305 GKDSQGNGSSSNSK-------SRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQ 362
            .....|.|.....|       |:|.|||:||.||:|||:|||..:||....|.::|..|.|||.|
Mouse   170 SSGGGGGGGGGGDKSPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQ 234

  Fly   363 VKIWFQNRRAKWKR-VKA-GLTSHGLGRN---------GTTSGTKIVV---------PIPV---- 403
            :||||||||.|:|: .|| ||.|...|.:         .:|:|....:         |.|.    
Mouse   235 IKIWFQNRRMKYKKDQKAKGLASSSGGPSPAGSPPQPMQSTAGFMNALHSMTPSYDSPSPPAFGK 299

  Fly   404 -HVNRFAVRSQHQQLEKMCLSGPK--PDLRKKLSAEAIGGFEKFSGSTNASSPSGGPVGLGVGVG 465
             |.|.:|:.|.:|...|.|.:..|  |....:.....:   :...|:....:..|.||.:|.|  
Mouse   300 GHQNAYALPSNYQPPLKGCGAPQKYPPTPASEYEPHVL---QANGGAYGTPTMQGSPVYVGGG-- 359

  Fly   466 VGVGVGLGVSTPL 478
                   |.:.||
Mouse   360 -------GYADPL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/50 (60%)
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 13/75 (17%)
Antp-type hexapeptide 129..134 1/9 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 15/58 (26%)
Homeobox 195..248 CDD:365835 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 6/26 (23%)
DUF4074 369..431 CDD:372548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.