DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxb1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_006532343.1 Gene:Hoxb1 / 15407 MGIID:96182 Length:330 Species:Mus musculus


Alignment Length:343 Identity:102/343 - (29%)
Similarity:132/343 - (38%) Gaps:93/343 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 EQELSARAMVASSALGLTQFPLYN-PWLHGYFAQNHERLTHLIAGGCYLPSSP----AGHPAAQQ 122
            |..|..|...|.||  .|.||..: |.:..|..::.      ..||  ||||.    :|:| .||
Mouse    11 EYPLCNRGPSAYSA--PTSFPPCSAPAVDSYAGESR------YGGG--LPSSALQQNSGYP-VQQ 64

  Fly   123 PQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVH 187
            |.:......|.|.|..:|         |...:..:.|....:.|.:..|.|           |.|
Mouse    65 PPSSLGVSFPSPAPSGYA---------PAACNPSYGPSQYYSVGQSEGDGS-----------YFH 109

  Fly   188 SLSVHARLQHMA---AAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDF 249
            ..|..|:|..:.   .||.:       |......|.||......|...|      |.|: :.||.
Mouse   110 PSSYGAQLGGLPDSYGAGGV-------GSGPYPPPQPPYGTEQTATFAS------AYDL-LSEDK 160

  Fly   250 ECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRH---------EGGGMG- 304
            |   ..||....|::||.::. |...||...|..          ||..|         ||...| 
Mouse   161 E---SPCSSEPSTLTPRTFDW-MKVKRNPPKTGR----------AQRSHFLSLARAYTEGPEPGL 211

  Fly   305 ----------GKDSQ-GNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKL 358
                      .|.|: |.|:...     .||.||:.||.|||:|||..||||...|.:||.:|:|
Mouse   212 HSFLQLLLLAAKVSELGLGAPGG-----LRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLEL 271

  Fly   359 SEVQVKIWFQNRRAKWKR 376
            :|.||||||||||.|.|:
Mouse   272 NETQVKIWFQNRRMKQKK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/50 (64%)
Hoxb1XP_006532343.1 Homeobox 236..289 CDD:365835 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.