DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxa6

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_034584.1 Gene:Hoxa6 / 15403 MGIID:96178 Length:232 Species:Mus musculus


Alignment Length:142 Identity:54/142 - (38%)
Similarity:71/142 - (50%) Gaps:23/142 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 GDSC--SDISLT-MSPRNYNGEMDKSRN-GAYTNSDSEDCSDDEGA---QSRHEGG--------- 301
            |.||  ||..|: .||...|    |.|. |.|.:...|.....:|:   ::.||.|         
Mouse    75 GASCFYSDKDLSGASPSGNN----KQRGPGDYLHFSPEQQYKPDGSVQGKALHEEGTDRKYTSPV 135

  Fly   302 --GMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVK 364
              .|...:|.. |:...|..||.|..:|..|.||||:|||..:||:...|.:||.:|.|:|.|:|
Mouse   136 YPWMQRMNSCA-GAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIK 199

  Fly   365 IWFQNRRAKWKR 376
            |||||||.|||:
Mouse   200 IWFQNRRMKWKK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/50 (54%)
Hoxa6NP_034584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..126 11/41 (27%)
Antp-type hexapeptide 135..140 0/4 (0%)
Homeobox 158..210 CDD:278475 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.