DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Gsx2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_573555.1 Gene:Gsx2 / 14843 MGIID:95843 Length:305 Species:Mus musculus


Alignment Length:248 Identity:74/248 - (29%)
Similarity:91/248 - (36%) Gaps:90/248 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMA 214
            |.|.|.:|.|                |::        |:...|...||    ...|.....||.|
Mouse   111 PAPGDAQFCP----------------RVS--------HAHHHHHPPQH----HHHHHQPQQPGSA 147

  Fly   215 QLQEPTPPQAHSSPAKSG---SHSPMEPALDVGMDEDFECSGDSCSDISLTMS-PRNYNGEMDKS 275
            .........|.::.|..|   .|:|:                  |:..:..|| ||.::      
Mouse   148 AAAAAAAAAAAAAAAALGHPQHHAPV------------------CAATTYNMSDPRRFH------ 188

  Fly   276 RNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHA 340
                        |.            .|||.|     :|.....:|.||||||.|||||||||.:
Mouse   189 ------------CL------------SMGGSD-----TSQVPNGKRMRTAFTSTQLLELEREFSS 224

  Fly   341 KKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTS 393
            ..|||...|.:|||.|.|||.||||||||||.|.|:     ...|..||..||
Mouse   225 NMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKK-----EGKGASRNNHTS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 36/50 (72%)
Gsx2NP_573555.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..151 12/63 (19%)
Homeobox 207..259 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..305 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.