DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Emx2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_034262.2 Gene:Emx2 / 13797 MGIID:95388 Length:253 Species:Mus musculus


Alignment Length:421 Identity:92/421 - (21%)
Similarity:130/421 - (30%) Gaps:201/421 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KPFPKP-FSIESLIANQTPATATPPSPPEERDQEQEAEQEQELSARAMVASSALGLTQFPLYNPW 88
            :|.||. |:||||:|..:|..|:....|                    :..:||........||:
Mouse     3 QPAPKRCFTIESLVAKDSPLPASRSEDP--------------------IRPAALSYANSSPINPF 47

  Fly    89 LHGYFAQNHERLTHLIAG-GCYLPSSP-------AGHPAAQQPQAQAQPQPPP------PHPPTH 139
            |:|:    |.......|| |.|  |:|       ..||  ..|.....|.|||      |.|.:|
Mouse    48 LNGF----HSAAAAAAAGRGVY--SNPDLVFAEAVSHP--PNPAVPVHPVPPPHALAAHPLPSSH 104

  Fly   140 ALEKQLPPTLPHPL-------DTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQH 197
            :         ||||       .:.|.|:                        .:|      |.::
Mouse   105 S---------PHPLFASQQRDPSTFYPW------------------------LIH------RYRY 130

  Fly   198 MAAAGRMHEDQANPGMAQLQEPTPPQA---HSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDI 259
            :.     |..|.|        .|.|::   |::.|:                             
Mouse   131 LG-----HRFQGN--------DTSPESFLLHNALAR----------------------------- 153

  Fly   260 SLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRT 324
                                                                      |.:|.||
Mouse   154 ----------------------------------------------------------KPKRIRT 160

  Fly   325 AFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRN 389
            ||:..|||.||..|....|:...||.|:|.||.|:|.|||:||||||.|:||.|  |...|....
Mouse   161 AFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQK--LEEEGSDSQ 223

  Fly   390 GTTSGTKIVVPIPVHVNRFAVRSQHQQLEKM 420
            ....||.       |:||:.:.::....|::
Mouse   224 QKKKGTH-------HINRWRIATKQASPEEI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/50 (56%)
Emx2NP_034262.2 Homeobox 159..212 CDD:395001 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..253 9/44 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.