DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Dlx4

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_031893.3 Gene:Dlx4 / 13394 MGIID:94904 Length:240 Species:Mus musculus


Alignment Length:253 Identity:63/253 - (24%)
Similarity:92/253 - (36%) Gaps:87/253 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PQPPPPHPPTHALEKQLPPTL----PHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSL 189
            |.|.|....::.:...|.|.|    .:||.     .:|..|  |..||||       :|.|.|..
Mouse     5 PCPLPDRGASNVVFPDLAPALSVVAAYPLG-----LSPGTA--ASPDLSY-------SQSYGHPR 55

  Fly   190 SVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGD 254
            |.            .|...|.||.:.|.......|.|.|    .|.|.|      ..::.|...:
Mouse    56 SY------------SHPGPATPGDSYLPRQQQLVAPSQP----FHRPAE------HPQELEAESE 98

  Fly   255 SCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKS 319
            .   ::|::.|                                            ....|...|.
Mouse    99 K---LALSLVP--------------------------------------------SQQQSLTRKL 116

  Fly   320 RRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRV 377
            |:.||.::|.||..|.:.|...:||:|.||:|:|..|.|::.||||||||:|:|:|::
Mouse   117 RKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/50 (50%)
Dlx4NP_031893.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..70 12/44 (27%)
Homeobox 119..172 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..194 63/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.