DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Dlx3

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_034185.1 Gene:Dlx3 / 13393 MGIID:94903 Length:287 Species:Mus musculus


Alignment Length:335 Identity:79/335 - (23%)
Similarity:114/335 - (34%) Gaps:141/335 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 HALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGR 203
            ||..|. .||||..               ..|||.|                 ::..||...:|:
Mouse    23 HAGSKD-SPTLPES---------------TVTDLGY-----------------YSAPQHDYYSGQ 54

  Fly   204 MHEDQANP----------GMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSD 258
            .:....||          |:               |.:|::||.                   |:
Mouse    55 PYGQTVNPYTYHHQFNLNGL---------------AGTGAYSPK-------------------SE 85

  Fly   259 ISLTMSPRNYNGEMDKSRNGAYTN-----SDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSK 318
            .:...|.|.|         |||..     .|.....::..|:.|...|             ...|
Mouse    86 YTYGGSYRQY---------GAYREQPLPAQDPVSVKEEPEAEVRMVNG-------------KPKK 128

  Fly   319 SRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTS 383
            .|:.||.::|.||..|:|.|...:||:|.||:::|..|.|::.||||||||||:|:|:       
Mouse   129 VRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKK------- 186

  Fly   384 HGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIGGFEKFSGST 448
              |.:||.       ||:.        .|.:......|.|.|.|.|           ::..|.||
Mouse   187 --LYKNGE-------VPLE--------HSPNNSDSMACNSPPSPAL-----------WDTSSHST 223

  Fly   449 NASSPSGGPV 458
            .|  |:..|:
Mouse   224 PA--PARNPL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 26/50 (52%)
Dlx3NP_034185.1 DLL_N 27..107 CDD:315147 26/155 (17%)
Abdominal-A <109..224 CDD:332641 46/162 (28%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:O60479 131..181 24/49 (49%)
Homeobox 132..185 CDD:306543 27/52 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..287 12/58 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.