DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and AgaP_AGAP010209

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_319393.4 Gene:AgaP_AGAP010209 / 1279631 VectorBaseID:AGAP010209 Length:451 Species:Anopheles gambiae


Alignment Length:277 Identity:68/277 - (24%)
Similarity:94/277 - (33%) Gaps:66/277 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 EDFECS--------GDS----------CSDISLTMSPRNYNG--------EMDKSRNGAYTNSDS 285
            |.|.||        ||.          |.:....:...:.||        |....:|..:||...
Mosquito   142 ECFRCSACARQLIPGDEFALRDGGSLYCKEDHDHLEKSSQNGLVQGAGKQERRIQKNNKHTNKRQ 206

  Fly   286 EDCSDDEGAQSRHEGGGMGG--KDSQGNGSS--SNSKSRRRRTAFTSEQLLELEREFHAKKYLSL 346
            ...|:..........|...|  |..:|.|.|  |:.|..|.||....:||..|...::|......
Mosquito   207 SSPSNANVVHVNQNSGSESGSHKSLRGKGPSGPSDGKPTRVRTVLNEKQLHTLRTCYNANPRPDA 271

  Fly   347 TERSQIATSLKLSEVQVKIWFQNRRAKWKR----VKAGLTSHGLGRN---GTTSGTKIVVPIPVH 404
            ..:.|:.....||...:::||||:|.|.|:    :|..:.....||.   | ..|..:|...|| 
Mosquito   272 LMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKTIQMKLQMQQEKEGRKLGYG-MQGIPMVASSPV- 334

  Fly   405 VNRFAVRSQHQQ------LEKMCLSGPKPDLRKKLSAEAIGGFEKFSGSTNASSPS--------- 454
                    :|..      ||......|    .|.||..|:......:||.|..:|:         
Mosquito   335 --------RHDSPLNLHGLEVTAYQPP----WKALSDFALHSDLDSNGSINTHTPAFQHLVNQMH 387

  Fly   455 GGPVGLGVGVGVGVGVG 471
            |..||.|.|.|.|.|.|
Mosquito   388 GYDVGNGGGGGPGGGPG 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 14/50 (28%)
AgaP_AGAP010209XP_319393.4 LIM1_Isl 56..110 CDD:188752
LIM2_Isl 118..173 CDD:188760 7/30 (23%)
COG5576 196..>318 CDD:227863 31/121 (26%)
HOX 244..300 CDD:197696 16/55 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.