DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and AgaP_AGAP007985

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_317481.4 Gene:AgaP_AGAP007985 / 1277963 VectorBaseID:AGAP007985 Length:354 Species:Anopheles gambiae


Alignment Length:285 Identity:70/285 - (24%)
Similarity:97/285 - (34%) Gaps:101/285 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 MAQLQEPTPPQAHSSPAKS----GSH-------SPMEPALDVGMDEDFECSGDSCSDISLTMSPR 266
            :|.|.:|:.|...|.....    |.|       ||:|.:...|     :..|.|           
Mosquito     5 LANLDQPSRPMGISDEGSRLEDIGPHEARPPQGSPLERSASTG-----QLMGSS----------- 53

  Fly   267 NYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQL 331
                       |...||...|...|:|                |:..:...|.||.||.|||.||
Mosquito    54 -----------GGDPNSPLSDPHSDDG----------------GDDFAPKRKQRRYRTTFTSFQL 91

  Fly   332 LELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKW-KRVKAGLTSHG----LGRNGT 391
            .|||:.|....|..:..|.::|..:.|:|.::::||||||||| |:.|.|...|.    |...|.
Mosquito    92 EELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQGHPYNPYLASAGQ 156

  Fly   392 TSGTKIVVP-IPVHVNRFAVRSQHQQLEKMCLSGPKP------DLRKKLSAEAIGGFE------- 442
            .....:|.| :|                      |.|      :|||...|.::..|.       
Mosquito   157 VPSATVVAPSLP----------------------PNPFSHLGFNLRKPFDAASLAAFRYPSLGGS 199

  Fly   443 ------KFSGSTNASSPSGGPVGLG 461
                  .|:....|..|...|.|:|
Mosquito   200 HMLPSAYFNQFHRAPPPPLLPPGVG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/51 (47%)
AgaP_AGAP007985XP_317481.4 Homeobox 83..135 CDD:278475 24/51 (47%)
OAR 321..338 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.