DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and AgaP_AGAP004660

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_311618.2 Gene:AgaP_AGAP004660 / 1272720 VectorBaseID:AGAP004660 Length:324 Species:Anopheles gambiae


Alignment Length:348 Identity:82/348 - (23%)
Similarity:113/348 - (32%) Gaps:120/348 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 EQELSARAMVASSALGLTQFPLYNPW-LHGYFAQNHERLTHLIAG------GCYLPSSPAGHPAA 120
            :|..|......::...:..:|.:.|: ..||:.|..:...:..|.      |..:|....|:| .
Mosquito    40 QQMYSHHNQAHANQANMPPYPRFPPYDRMGYYQQTMDPAGYARADSPSSQVGGVIPPQSNGNP-L 103

  Fly   121 QQPQAQAQPQPP---------------PPHPPTHALEKQLPP--TLPHPLDTRFLPFNPAAAGVA 168
            ||.|.|.|.|.|               |....|:..|...||  .:.|.:            |.|
Mosquito   104 QQTQVQPQQQQPIVYASCKLQAAVGNGPNGLGTYGTENGSPPLDQMGHHM------------GTA 156

  Fly   169 PTDLSYRRLAELMNQDYVHSLSVHARLQHM-----AAAGRMHEDQANPGMAQLQEPTPPQAHSSP 228
            ...:....:.....|: .:...||...|||     |..|.....|..|.|...|.|...|...:|
Mosquito   157 QMTIPQHHMGHSQGQE-CYPEQVHQTPQHMAMYTNAGGGPPGVTQQQPNMMHQQPPPLHQGQQAP 220

  Fly   229 -----AKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDC 288
                 |.||..||:.|    .|...||                                      
Mosquito   221 PNSQNASSGLQSPLYP----WMRSQFE-------------------------------------- 243

  Fly   289 SDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIA 353
                                          .:|.|..:|..|.||||:|||..:||:...|.:||
Mosquito   244 ------------------------------RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIA 278

  Fly   354 TSLKLSEVQVKIWFQNRRAKWKR 376
            .:|.|:|.|:||||||||.|||:
Mosquito   279 HALCLTERQIKIWFQNRRMKWKK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/50 (54%)
AgaP_AGAP004660XP_311618.2 Homeobox 248..300 CDD:278475 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.