DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and AgaP_AGAP010359

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_311581.3 Gene:AgaP_AGAP010359 / 1272680 VectorBaseID:AGAP010359 Length:172 Species:Anopheles gambiae


Alignment Length:184 Identity:46/184 - (25%)
Similarity:73/184 - (39%) Gaps:57/184 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 VHARLQHMAAAGRMHEDQANPGMA--QLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSG 253
            |.||::.|        .:.|||:.  :::|..        .|.|...|                 
Mosquito    38 VEARIEDM--------KKMNPGIFSWEIREKL--------IKEGVTDP----------------- 69

  Fly   254 DSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSS--- 315
            .|.|.||..:.    .|.:|..|            .||:|.:.....|.:||:.|..:.:.|   
Mosquito    70 PSVSSISRLLR----GGGVDPGR------------KDDDGRKDYSIHGILGGRGSDSSDTESEPG 118

  Fly   316 ---NSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIW 366
               ..|.||.||.||||||..||:.|...:|..:..|.::|::..|:|.::::|
Mosquito   119 ILLKRKQRRSRTTFTSEQLEALEKAFTRTQYPDVYTREELASTTNLTEARIQVW 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 16/43 (37%)
AgaP_AGAP010359XP_311581.3 HTH <1..80 CDD:304362 15/74 (20%)
Homeobox 128..172 CDD:278475 16/43 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.