DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and AgaP_AGAP013373

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_003436924.1 Gene:AgaP_AGAP013373 / 11175540 VectorBaseID:AGAP013373 Length:216 Species:Anopheles gambiae


Alignment Length:190 Identity:52/190 - (27%)
Similarity:81/190 - (42%) Gaps:51/190 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 SKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWK------ 375
            ::.|:.|.|:::.||..||.||....||::.:|.::|..|.|:|.|:|.||||||.|:|      
Mosquito    17 NRERKPRQAYSAMQLERLEDEFQRNIYLNVNKRFELAQCLGLTETQIKTWFQNRRTKFKKQQDSR 81

  Fly   376 -----RVKAGLTSHGLGR---------NGTTSGTKIVVPIPVHVNRFAVR--------------- 411
                 |.:|.|.:..|.:         :|.......:..:|||.:..|:.               
Mosquito    82 NKREQRQQAQLIAQWLFQPPQLGSIPLDGQLQPLPRLAALPVHRSSLALAQGTLQSALMAPYHLL 146

  Fly   412 -------SQHQQLEKMCL-SGP---KPDLRKKLSAEAIGGFE---KFSGSTNASS-PSGG 456
                   .|||..::..| .||   ||....: |..|:..|.   .|:.|:..|| .:||
Mosquito   147 PPTSLTVQQHQHQQRCALEDGPRVVKPVYTVR-SPNAVPAFPTAVPFATSSVVSSLQTGG 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 23/50 (46%)
AgaP_AGAP013373XP_003436924.1 Homeobox 22..75 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.