DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxc11

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001020013.1 Gene:Hoxc11 / 109663 MGIID:96193 Length:304 Species:Mus musculus


Alignment Length:306 Identity:71/306 - (23%)
Similarity:114/306 - (37%) Gaps:75/306 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 GGC----YLPSSPAGHP-----AAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFN 161
            |.|    ||||.....|     ::..|||       |....::....|:||.            .
Mouse    26 GSCTSNLYLPSCTYYVPEFSTVSSFLPQA-------PSRQISYPYSAQVPPV------------R 71

  Fly   162 PAAAGVAPT---------DLSYRRLAELMNQDYVHSLSV---------------HARLQHMAAAG 202
            ..:.|:.|:         ...|....|||:::.:...:|               |....|.|.||
Mouse    72 EVSYGLEPSGKWHHRNSYSSCYAAADELMHRECLPPSTVTEILMKNEGSYGGHHHPSAPHAAPAG 136

  Fly   203 RMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRN 267
            .......|..:.|..:.....|:.    .|..:|.||          .|||...:.......|. 
Mouse   137 FYSSVNKNSVLPQAFDRFFDNAYC----GGGDAPAEP----------PCSGKGEAKGEPEAPPA- 186

  Fly   268 YNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNS-KSRRRRTAFTSEQL 331
             :|...::..||      |..:::|.......|...........|::.|: ::|::|..::..|:
Mouse   187 -SGLASRAEAGA------EAEAEEENTNPSSSGSSHSATKEPAKGAAPNAPRTRKKRCPYSKFQI 244

  Fly   332 LELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRV 377
            .||||||....|::..:|.|::..|.|::.||||||||||.|.|::
Mouse   245 RELEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 23/50 (46%)
Hoxc11NP_001020013.1 DUF3528 42..178 CDD:403310 30/168 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..237 15/87 (17%)
Homeobox 235..289 CDD:395001 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.