DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and CPHXL

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001342542.1 Gene:CPHXL / 105371346 HGNCID:51815 Length:405 Species:Homo sapiens


Alignment Length:180 Identity:40/180 - (22%)
Similarity:61/180 - (33%) Gaps:39/180 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 GGMGGKDSQGN--GSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQV 363
            ||...::...|  ..:.|.:..:.|..|:.|.|.||:..|....|...|.|..:|.........:
Human     8 GGFPAEEDHHNEERQTKNKRKTKHRHKFSEELLQELKEIFGENCYPDYTTRKTLAIKFDCPVNVI 72

  Fly   364 KIWFQNRRAKW-----KRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRF-----AVRSQHQQLE 418
            ..||||:||:.     :|:......|               ..||..:.|     ...:.|....
Human    73 DNWFQNKRARLPPAERRRIFVLQKKH---------------DFPVQAHSFLSCQETQAAAHNYAT 122

  Fly   419 KMCLSGPKPDLRKKLSAEAIG---------GFEKFSGSTNASSPSG--GP 457
            |..|||.:..|.::.....:.         |:..|| ..|..:||.  ||
Human   123 KQSLSGAQRALMRRAGCSHLEKQWIPSQEMGYNCFS-LENQETPSQQVGP 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 16/55 (29%)
CPHXLNP_001342542.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 4/24 (17%)
HOX 28..82 CDD:197696 16/53 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..363
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.