DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and HOXB13

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_006352.2 Gene:HOXB13 / 10481 HGNCID:5112 Length:284 Species:Homo sapiens


Alignment Length:296 Identity:76/296 - (25%)
Similarity:114/296 - (38%) Gaps:41/296 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 AQNHERLTHLIAGGCYLPSSP-AGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRF 157
            |::.|.|.....|...:..|| ..||||           |...|..:.....||.:...|.....
Human    12 AKDIEGLLGAGGGRNLVAHSPLTSHPAA-----------PTLMPAVNYAPLDLPGSAEPPKQCHP 65

  Fly   158 LPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPP 222
            .|..|.....||....|      ....|.......:.|:..|.|..:....|....|..:.|:.|
Human    66 CPGVPQGTSPAPVPYGY------FGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEYPSRP 124

  Fly   223 QAHS-SPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNS-DS 285
            ...: .|...|::.||...|||.:.:.....|:...|..|         .:|..::.|.... :|
Human   125 TEFAFYPGYPGTYQPMASYLDVSVVQTLGAPGEPRHDSLL---------PVDSYQSWALAGGWNS 180

  Fly   286 EDCSDDEGAQSRHEGGGMGGK----DSQGN---GSSSNSKSRRRRTAFTSEQLLELEREFHAKKY 343
            :.|     .|......|...|    ||.|.   .:.:..:.|::|..::..||.|||||:.|.|:
Human   181 QMC-----CQGEQNPPGPFWKAAFADSSGQHPPDACAFRRGRKKRIPYSKGQLRELEREYAANKF 240

  Fly   344 LSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKA 379
            ::..:|.:|:.:..|||.|:.|||||||.|.|:|.|
Human   241 ITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 23/50 (46%)
HOXB13NP_006352.2 HoxA13_N 12..121 CDD:372013 26/125 (21%)
HOX 216..272 CDD:197696 25/55 (45%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536, ECO:0000305|Ref.8 217..246 11/28 (39%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000305|PubMed:28473536 258..269 7/10 (70%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536, ECO:0000305|Ref.8 270..273 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.