DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and CDX4

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_005184.1 Gene:CDX4 / 1046 HGNCID:1808 Length:284 Species:Homo sapiens


Alignment Length:211 Identity:56/211 - (26%)
Similarity:78/211 - (36%) Gaps:91/211 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 TNSDSEDCSDDEGAQSRHEGGGMGGKD--SQGNGS-----------SSNSKSR------------ 320
            |:|.:..||.|. :.....|||..|..  .|..||           ||.|:||            
Human   102 TSSPAAFCSTDY-SNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQ 165

  Fly   321 ---------RRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
                     :.|..:|..|.||||:|||..:|:::..:|::|.:|.|||.||||||||||||.::
Human   166 VTGKTRTKEKYRVVYTDHQRLELEKEFHCNRYITIQRKSELAVNLGLSERQVKIWFQNRRAKERK 230

  Fly   377 VKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIGGF 441
            :                                                   ::||:|.     |
Human   231 M---------------------------------------------------IKKKISQ-----F 239

  Fly   442 EKFSGSTNASSPSGGP 457
            |...||..:.|.|..|
Human   240 ENSGGSVQSDSDSISP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/50 (56%)
CDX4NP_005184.1 Caudal_act 13..162 CDD:309740 17/60 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..155 12/34 (35%)
Homeobox 177..229 CDD:306543 29/51 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..259 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.