DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxb2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_598793.2 Gene:Hoxb2 / 103889 MGIID:96183 Length:354 Species:Mus musculus


Alignment Length:275 Identity:79/275 - (28%)
Similarity:101/275 - (36%) Gaps:81/275 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 GMAQLQEP-TPPQAHSSPA-KSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDK 274
            |.:.||.| :..||...|| :|....|:.|.                       :|     |...
Mouse    59 GASTLQRPGSQKQAGDGPALRSPPPLPVAPP-----------------------AP-----EFPW 95

  Fly   275 SRNGAYTNSDSEDCSDDEGAQSRHEGGGMGG-KDSQGNGSSSNSKSRRRRTAFTSEQLLELEREF 338
            .:....|...|:..:....|.|......:|. .|..|......|.|||.|||:|:.||||||:||
Mouse    96 MKEKKSTKKPSQSAASPSPAASSVRASEVGSPSDGPGLPECGGSGSRRLRTAYTNTQLLELEKEF 160

  Fly   339 HAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGTK------- 396
            |..|||....|.:||..|.|:|.|||:||||||.|.||    .|.|.....|...|..       
Mouse   161 HFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKR----QTQHREPPEGEPGGPSAQDDAGE 221

  Fly   397 -----IVVPIPVHVNRFAVRSQHQQLEKMCL------SGPK---PDLRKKLSAEAIGGFEKFSGS 447
                 .|.|..|..:|         |.:.|.      .||:   |......:.|::|        
Mouse   222 PAEEPTVSPGDVATHR---------LREACFHPAEAAQGPRGAPPSALPATTLESVG-------- 269

  Fly   448 TNASSP------SGG 456
              ||||      :||
Mouse   270 --ASSPGCTMLRAGG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/50 (62%)
Hoxb2NP_598793.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..143 22/111 (20%)
Antp-type hexapeptide 92..97 1/4 (25%)
Homeobox 145..197 CDD:278475 32/51 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..231 9/41 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..295 11/47 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.