powered by:
Protein Alignment unpg and LOC101731897
DIOPT Version :9
Sequence 1: | NP_477146.1 |
Gene: | unpg / 35942 |
FlyBaseID: | FBgn0015561 |
Length: | 485 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004913865.2 |
Gene: | LOC101731897 / 101731897 |
-ID: | - |
Length: | 130 |
Species: | Xenopus tropicalis |
Alignment Length: | 58 |
Identity: | 17/58 - (29%) |
Similarity: | 23/58 - (39%) |
Gaps: | 14/58 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 EQEQELSARAMVASSALGLTQFPLYNPWLHGYFAQNHERLTHLIAGGCYLPSSPAGHP 118
:|..:..|:|...||..|| |||: .|:..|:..|.|.....||.|
Frog 6 KQGGKTRAKAKTRSSRAGL-QFPV-------------GRVHRLLRKGNYAERVGAGAP 49
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
unpg | NP_477146.1 |
Homeobox |
324..375 |
CDD:278475 |
|
LOC101731897 | XP_004913865.2 |
PTZ00017 |
1..130 |
CDD:185399 |
17/58 (29%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.