DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxa4

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_077326.1 Gene:Hoxa4 / 100912525 RGDID:2814 Length:285 Species:Rattus norvegicus


Alignment Length:295 Identity:82/295 - (27%)
Similarity:111/295 - (37%) Gaps:112/295 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SPAGHPAAQQ---------PQAQAQPQPPPPHPPTHALEKQLP----PTLPHPLDTRFLPFNPAA 164
            :|.|.|....         |:.|:.|..|.|:|  || .:|.|    |....|.....|...|||
  Rat    24 APHGGPGGGDGGVGGGPGYPRPQSSPHLPAPNP--HA-ARQTPAYYAPRAREPSYHGGLYPAPAA 85

  Fly   165 A------GVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQ 223
            |      |.:|                       ||.:...|.|      |:|..|    |.|| 
  Rat    86 ACPYACRGASP-----------------------ARPEQSPAPG------AHPSPA----PQPP- 116

  Fly   224 AHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDC 288
               :|.:..:..|..||:         .:|.|.....|.::                        
  Rat   117 ---APPRRCAPGPTTPAV---------ATGGSAPACPLLLA------------------------ 145

  Fly   289 SDDEGAQSRHEGGGMGGKD------------SQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAK 341
              |:|.      .|..||:            |..|.|.:..:.:|.|||:|.:|:||||:|||..
  Rat   146 --DQGP------AGPKGKEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFN 202

  Fly   342 KYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
            :||:...|.:||.:|.|||.||||||||||.|||:
  Rat   203 RYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/50 (62%)
Hoxa4NP_077326.1 Homeobox 183..236 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.