DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxc11

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_038934166.1 Gene:Hoxc11 / 100911859 RGDID:6489991 Length:329 Species:Rattus norvegicus


Alignment Length:113 Identity:31/113 - (27%)
Similarity:42/113 - (37%) Gaps:34/113 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ATATPP-SPPEERDQEQEAEQEQELSARAMVASSALGLTQFPLYNPWLHGYFAQNHERLTHLIAG 106
            |.|.|| |...|...|.||.....|::||..                  |..|:..|..|:    
  Rat   165 APAEPPCSGKGEAKGEPEAPPASGLASRAEA------------------GAEAEAEEENTN---- 207

  Fly   107 GCYLPSSP-AGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPP-TLPHP 152
                |||. :.|.|.::|...|.|...||:|     ::.||. .:|.|
  Rat   208 ----PSSSGSSHSATKEPAKGAAPSRRPPNP-----QEALPLFEIPDP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475
Hoxc11XP_038934166.1 DUF3528 42..178 CDD:403310 6/12 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.