DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and LOC100911668

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_006257771.1 Gene:LOC100911668 / 100911668 RGDID:6491746 Length:413 Species:Rattus norvegicus


Alignment Length:316 Identity:85/316 - (26%)
Similarity:116/316 - (36%) Gaps:101/316 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 PAGHPAAQ-QPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRF------------------LP 159
            |.|.|..| |||.|.||.||||.||.       ||  |......|                  .|
  Rat   131 PDGPPPPQPQPQQQQQPPPPPPQPPQ-------PP--PQATSCSFAQNIKEESSYCLYDSADKCP 186

  Fly   160 FNPAAAGVAPTDL------------------SYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHE 206
            ...|||.:||...                  .|.||::                .:..|.|    
  Rat   187 KGSAAADLAPFPRGPPPDGCALGASSGVPVPGYFRLSQ----------------AYGTAKG---- 231

  Fly   207 DQANPGMAQLQEPTPPQAHS------SPAKSGS--HSPMEPALDVGMDEDFECSGDSCSDISLTM 263
             ..:.|..||..|.|.|...      |...|||  .:..|..||........|:|...|      
  Rat   232 -FGSGGTQQLASPFPAQPPGRGFDPPSALASGSAEAAGKERVLDSTPPPTLVCAGGGSS------ 289

  Fly   264 SPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNS-------KSRR 321
                   :.|:..:.:.:.::....:..|.:::..|      |||.||..|.|:       ..|:
  Rat   290 -------QADEEAHASSSAAEELSPAPSENSKASPE------KDSLGNSKSENAANWLTAKSGRK 341

  Fly   322 RRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRV 377
            :|..:|..|.||||:||....||:...|.:|:.|:.|::.||||||||||.|.|::
  Rat   342 KRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKM 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/50 (50%)
LOC100911668XP_006257771.1 Homeobox 342..395 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.