DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxd13

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_002935723.1 Gene:hoxd13 / 100498102 XenbaseID:XB-GENE-482320 Length:300 Species:Xenopus tropicalis


Alignment Length:203 Identity:56/203 - (27%)
Similarity:82/203 - (40%) Gaps:61/203 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 SPAKSGSHS-----PMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDK--SRNGAYTN-- 282
            :|.||.||:     |:|..:||             |.::.|..|.|......|  |....|||  
 Frog   106 NPLKSSSHASLGGFPVEKYMDV-------------SGLASTSVPSNEVSSRAKEVSYFQGYTNPY 157

  Fly   283 -------------SDSEDCSDD----EGAQSRHEGGGMGG-----KDSQ-----------GNGSS 314
                         |..|...:.    ||.||.....|..|     ||..           |:.:.
 Frog   158 QHVPGYLDMVSTFSSGEPRHEAYISMEGYQSWTLANGWNGQVYCPKDQSQAPHFWKSSFPGDVAL 222

  Fly   315 SNS------KSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAK 373
            :.:      :.|::|..:|..||.|||.|:...|:::..:|.:|:.:..|||.||.|||||||.|
 Frog   223 NQADMCVYRRGRKKRVPYTKLQLKELENEYAVNKFINKDKRRRISAATNLSERQVTIWFQNRRVK 287

  Fly   374 WKRVKAGL 381
            .|::.:.|
 Frog   288 DKKIVSKL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 23/50 (46%)
hoxd13XP_002935723.1 HoxA13_N 11..129 CDD:372013 9/35 (26%)
Homeobox 236..290 CDD:365835 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.