DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and ventx2.2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_002937178.3 Gene:ventx2.2 / 100494704 XenbaseID:XB-GENE-920515 Length:333 Species:Xenopus tropicalis


Alignment Length:204 Identity:63/204 - (30%)
Similarity:94/204 - (46%) Gaps:54/204 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 QANP--GMAQLQEPTPPQA-HSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSP---- 265
            |.:|  |.||: .|.|..| :||.::|..:|        ..|||..|.    .|::...:|    
 Frog    62 QLSPVAGSAQV-SPCPGSAQYSSDSESSLYS--------NEDEDLFCE----KDLNTPSTPGDNG 113

  Fly   266 --------RNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSK---- 318
                    .:|:|.:....|...|.      |:::.|:|.:......|.:|:.:.|||.:.    
 Frog   114 LLHKDTATHDYSGMVSVPANTPRTT------SNEDAAKSGYSTSTDSGYESEASRSSSTAPEGDA 172

  Fly   319 ----------------SRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWF 367
                            .||.||||||:|:..||:.|...:||..:||.::|..|:|||||:|.||
 Frog   173 TVSLSPNDTSDEEGKLGRRLRTAFTSDQISTLEKTFQKHRYLGASERRKLAAKLQLSEVQIKTWF 237

  Fly   368 QNRRAKWKR 376
            ||||.|:||
 Frog   238 QNRRMKYKR 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/50 (56%)
ventx2.2XP_002937178.3 Homeobox 193..246 CDD:395001 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.