DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxb1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_004918719.1 Gene:hoxb1 / 100493290 XenbaseID:XB-GENE-485772 Length:304 Species:Xenopus tropicalis


Alignment Length:324 Identity:90/324 - (27%)
Similarity:122/324 - (37%) Gaps:100/324 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SPAGHPAAQQPQAQAQPQPPPPHP-----------------------PTHALEKQLPPTLPHPLD 154
            ||.|:...:        |..||.|                       |:| |.:|.|...|.|  
 Frog    23 SPRGYHHFE--------QGTPPFPACPGTNDIYNGDGRFVVGGGNGVPSH-LHQQNPSYPPQP-- 76

  Fly   155 TRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHS-----------LSVHARLQHMAAAGRMHED- 207
                     :|||..|:.......:..||.|.|.           ....|...:..|....:.| 
 Frog    77 ---------SAGVPYTNSLTSYTPQTCNQAYGHQAYASPDADGIYFQQTAYCSNTGANSNSYSDG 132

  Fly   208 --QANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSC-SDISLTMSPRNYN 269
              .|.||.||.|:....|.|....:: .|:|  |::   :.|:.|   .|| |:.:|   |.:..
 Frog   133 YCGAVPGPAQYQQHPYGQEHQGLLQA-YHNP--PSM---LHEEKE---PSCPSEQAL---PNHTF 185

  Fly   270 GEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLEL 334
            ..|...||...|.:...|.                |..:|.|         ..||.||::||.||
 Frog   186 DWMKVKRNPPKTTAKPVDF----------------GLSTQQN---------TIRTNFTTKQLTEL 225

  Fly   335 EREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKW-KRVKAGLT----SHGLGRNGTTS 393
            |:|||..|||:...|.:||.:|:|:|.||||||||||.|. ||.:.||.    ...:..||..|
 Frog   226 EKEFHFNKYLTRARRVEIAATLELNETQVKIWFQNRRMKQKKREREGLAPSAIKGSMKENGEMS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/51 (61%)
hoxb1XP_004918719.1 PTZ00395 <12..>147 CDD:185594 31/143 (22%)
Homeobox 214..267 CDD:365835 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.