DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and trhr3

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_002933212.1 Gene:trhr3 / 100489565 XenbaseID:XB-GENE-6492473 Length:404 Species:Xenopus tropicalis


Alignment Length:85 Identity:15/85 - (17%)
Similarity:33/85 - (38%) Gaps:10/85 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 SDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLT 347
            |:.:|.|   ...|:|.|.........|.|:.:.:.||::.|...:..::..       ..|.:.
 Frog   232 SNPQDLS---RMSSKHYGKPYNSIKLSGKGNKNTASSRKQVTKMLAVVVILF-------ALLWMP 286

  Fly   348 ERSQIATSLKLSEVQVKIWF 367
            .|:.:..:..:....:.:||
 Frog   287 YRTLVVVNSFMDPPYLNVWF 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 5/44 (11%)
trhr3XP_002933212.1 7tmA_TRH-R 34..336 CDD:320126 15/85 (18%)
TM helix 1 35..61 CDD:320126
TM helix 2 68..93 CDD:320126
TM helix 3 105..135 CDD:320126
TM helix 4 148..169 CDD:320126
TM helix 5 195..224 CDD:320126
TM helix 6 264..294 CDD:320126 5/36 (14%)
TM helix 7 304..329 CDD:320126 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.