DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and nkx6-3

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_002932753.1 Gene:nkx6-3 / 100489301 XenbaseID:XB-GENE-478609 Length:255 Species:Xenopus tropicalis


Alignment Length:293 Identity:69/293 - (23%)
Similarity:103/293 - (35%) Gaps:115/293 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 THLIAGGCYLPSSPAGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAA 165
            |.:.:.||..|:                      |.|.|.|                   ||:..
 Frog    16 TEMKSSGCQFPA----------------------HTPFHKL-------------------NPSVL 39

  Fly   166 GVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSS--- 227
            |.                             |: .:|..|      |::.:.....|.:||.   
 Frog    40 GC-----------------------------HL-PSGTPH------GISDILSRPLPASHSGMFP 68

  Fly   228 --PAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSD 290
              |...|..|...|.         .|.|:..|.::.:.:|              ||| .|..|..
 Frog    69 GYPTVQGYGSSSVPG---------SCYGEQGSILTKSGTP--------------YTN-QSRGCWT 109

  Fly   291 DEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRT--AFTSEQLLELEREFHAKKYLSLTERSQIA 353
            |      .|....||..:..:.|::...||::.|  .||..|:..||:.|...|||:..||:::|
 Frog   110 D------IEQDWRGGNRALSSVSNTEGSSRKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLA 168

  Fly   354 TSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGL 386
            .||.:||.|||:||||||.||:: |:.:.:.||
 Frog   169 FSLGMSESQVKVWFQNRRTKWRK-KSAVETPGL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/52 (52%)
nkx6-3XP_002932753.1 Homeobox 137..190 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.