DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and LOC100487588

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_002943222.1 Gene:LOC100487588 / 100487588 -ID:- Length:130 Species:Xenopus tropicalis


Alignment Length:58 Identity:17/58 - (29%)
Similarity:23/58 - (39%) Gaps:14/58 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EQEQELSARAMVASSALGLTQFPLYNPWLHGYFAQNHERLTHLIAGGCYLPSSPAGHP 118
            :|..:..|:|...||..|| |||:             .|:..|:..|.|.....||.|
 Frog     6 KQGGKTRAKAKTRSSRAGL-QFPV-------------GRVHRLLRKGNYAERVGAGAP 49

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475
LOC100487588XP_002943222.1 PTZ00017 1..130 CDD:185399 17/58 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.