DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and nkx1-2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_002937845.1 Gene:nkx1-2 / 100486193 XenbaseID:XB-GENE-854960 Length:246 Species:Xenopus tropicalis


Alignment Length:268 Identity:78/268 - (29%)
Similarity:115/268 - (42%) Gaps:58/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 EDQANPGMAQLQEP---TPPQAHS--SPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTM-S 264
            |:::.||...|..|   |....|:  ...|.|:..|       ||.|.        .|..||: |
 Frog    10 EEKSVPGQKHLHTPFFITDILNHAKVQQVKEGTQEP-------GMKEK--------GDTGLTLPS 59

  Fly   265 PRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSE 329
            ....:|...|:..   :..:.|:..:.|..|           ::|...|.:|.|.||.|||||.|
 Frog    60 DSMVSGPEIKAET---SPGEPEELPEKEENQ-----------ETQNVPSVTNCKPRRARTAFTYE 110

  Fly   330 QLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRN----G 390
            ||:.||..|.:.:|||:.||..:|.:|.|:|.||||||||||.|||:.:...:..|.|.:    .
 Frog   111 QLVALESRFRSSRYLSVCERLSLALTLHLTETQVKIWFQNRRTKWKKQQPIGSLEGRGCSIQNCP 175

  Fly   391 TTSGTKIVVPIP-----VHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIG------GFEKF 444
            |..|.:...|:|     .|:......:.|       || |.|.:.....:.:.|      .:.:|
 Frog   176 TIPGPRFTPPLPNYPCATHIPHIGAGANH-------LS-PFPGIFFSPPSTSFGLSPTGATYPQF 232

  Fly   445 SGSTNASS 452
            .||:..:|
 Frog   233 IGSSRFTS 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/50 (60%)
nkx1-2XP_002937845.1 Homeobox 104..157 CDD:365835 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.