DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and lrp1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_002939758.3 Gene:lrp1 / 100485788 XenbaseID:XB-GENE-479843 Length:4543 Species:Xenopus tropicalis


Alignment Length:66 Identity:20/66 - (30%)
Similarity:30/66 - (45%) Gaps:21/66 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 FECSGDS-CSDISLTMSPRNYNGE------------MDKSR--NGAYT---NSDSEDCSDDEGAQ 295
            :.|.||: |.|   |...:|.:||            .|.:|  :.|:.   :||.||.||:|..:
 Frog  1084 WRCDGDTDCMD---TSDEKNCDGETRPCDPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEENCE 1145

  Fly   296 S 296
            |
 Frog  1146 S 1146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475
lrp1XP_002939758.3 LDLa 34..67 CDD:197566
Ldl_recept_a 78..112 CDD:395011
FXa_inhibition 127..156 CDD:405372
FXa_inhibition 168..196 CDD:405372
LY 283..322 CDD:214531
LY 325..366 CDD:214531
LY 369..409 CDD:214531
FXa_inhibition 494..527 CDD:405372
LY 559..601 CDD:214531
LY 602..641 CDD:214531
LY 648..697 CDD:214531
LY <708..741 CDD:214531
FXa_inhibition 811..846 CDD:405372
LDLa 857..889 CDD:197566
LDLa 899..932 CDD:238060
LDLa 939..971 CDD:197566
LDLa 982..1015 CDD:238060
LDLa 1019..1052 CDD:238060
LDLa 1066..1101 CDD:238060 6/19 (32%)
LDLa 1108..1144 CDD:238060 10/35 (29%)
LDLa 1149..1182 CDD:197566
FXa_inhibition 1189..1225 CDD:405372
LY 1340..1382 CDD:214531
LY 1384..1427 CDD:214531
LY 1428..1471 CDD:214531
FXa_inhibition 1544..1582 CDD:405372
LY 1617..1653 CDD:214531
LY 1654..1697 CDD:214531
LY 1701..1738 CDD:214531
LY 1738..1779 CDD:214531
FXa_inhibition 1851..1887 CDD:405372
LY 1960..2000 CDD:214531
LY 2001..2044 CDD:214531
LY 2046..2088 CDD:214531
FXa_inhibition 2160..2195 CDD:405372
YvrE 2253..>2443 CDD:225921
Ldl_recept_b 2343..2384 CDD:395012
LY 2369..2410 CDD:214531
LDLa 2527..2556 CDD:238060
LDLa 2565..2599 CDD:238060
LDLa 2604..2638 CDD:238060
LDLa <2665..2687 CDD:238060
LDLa 2695..2729 CDD:238060
LDLa 2733..2764 CDD:197566
LDLa 2772..2805 CDD:197566
LDLa 2816..2848 CDD:197566
LDLa 2856..2889 CDD:197566
LDLa 2903..2937 CDD:238060
cEGF 2960..2983 CDD:403760
EGF_CA 2980..3014 CDD:214542
LY 3050..3094 CDD:214531
LY 3095..3137 CDD:214531
LY 3139..3181 CDD:214531
LY 3183..3224 CDD:214531
LY 3225..3265 CDD:214531
FXa_inhibition 3295..3331 CDD:405372
LDLa 3335..3366 CDD:238060
LDLa 3375..3409 CDD:238060
LDLa 3414..3449 CDD:238060
LDLa 3453..3486 CDD:197566
LDLa 3494..3527 CDD:197566
LDLa 3537..3571 CDD:238060
Ldl_recept_a 3574..3610 CDD:395011
LDLa 3614..3648 CDD:238060
LDLa 3654..3686 CDD:197566
LDLa 3696..3732 CDD:238060
LDLa 3745..3775 CDD:238060
LY 3954..3990 CDD:214531
Ldl_recept_b 4011..4051 CDD:395012
LY 4035..4076 CDD:214531
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.