powered by:
Protein Alignment unpg and lrp1
DIOPT Version :9
Sequence 1: | NP_477146.1 |
Gene: | unpg / 35942 |
FlyBaseID: | FBgn0015561 |
Length: | 485 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002939758.3 |
Gene: | lrp1 / 100485788 |
XenbaseID: | XB-GENE-479843 |
Length: | 4543 |
Species: | Xenopus tropicalis |
Alignment Length: | 66 |
Identity: | 20/66 - (30%) |
Similarity: | 30/66 - (45%) |
Gaps: | 21/66 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 249 FECSGDS-CSDISLTMSPRNYNGE------------MDKSR--NGAYT---NSDSEDCSDDEGAQ 295
:.|.||: |.| |...:|.:|| .|.:| :.|:. :||.||.||:|..:
Frog 1084 WRCDGDTDCMD---TSDEKNCDGETRPCDPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEENCE 1145
Fly 296 S 296
|
Frog 1146 S 1146
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X14 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.