powered by:
Protein Alignment unpg and kif2a
DIOPT Version :9
Sequence 1: | NP_477146.1 |
Gene: | unpg / 35942 |
FlyBaseID: | FBgn0015561 |
Length: | 485 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002934245.2 |
Gene: | kif2a / 100379688 |
XenbaseID: | XB-GENE-951755 |
Length: | 745 |
Species: | Xenopus tropicalis |
Alignment Length: | 129 |
Identity: | 26/129 - (20%) |
Similarity: | 42/129 - (32%) |
Gaps: | 47/129 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 123 PQAQAQPQP--PPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDY 185
|..:..|.| |||..||..:.|.:. :.|.:|.:.|:
Frog 67 PDEEIDPGPEMPPPPTPTTKVNKIVK--------------------------NRRTVAPVKNE-- 103
Fly 186 VHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDF 249
..||...:||. ..|:.:...|.:..:|..::||.|.:.| |....:||
Frog 104 -----TPARDNRVAAV----------SSARARPSQPIEQSASAQQNGSVSDISP--DQPGKKDF 150
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
unpg | NP_477146.1 |
Homeobox |
324..375 |
CDD:278475 |
|
kif2a | XP_002934245.2 |
KISc_KIF2_like |
224..552 |
CDD:276818 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0489 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X14 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.