DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and kif2a

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_002934245.2 Gene:kif2a / 100379688 XenbaseID:XB-GENE-951755 Length:745 Species:Xenopus tropicalis


Alignment Length:129 Identity:26/129 - (20%)
Similarity:42/129 - (32%) Gaps:47/129 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 PQAQAQPQP--PPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDY 185
            |..:..|.|  |||..||..:.|.:.                          :.|.:|.:.|:  
 Frog    67 PDEEIDPGPEMPPPPTPTTKVNKIVK--------------------------NRRTVAPVKNE-- 103

  Fly   186 VHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDF 249
                 ..||...:||.          ..|:.:...|.:..:|..::||.|.:.|  |....:||
 Frog   104 -----TPARDNRVAAV----------SSARARPSQPIEQSASAQQNGSVSDISP--DQPGKKDF 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475
kif2aXP_002934245.2 KISc_KIF2_like 224..552 CDD:276818
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.