DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and arxb

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_002667096.1 Gene:arxb / 100329907 ZFINID:ZDB-GENE-121109-2 Length:385 Species:Danio rerio


Alignment Length:284 Identity:80/284 - (28%)
Similarity:103/284 - (36%) Gaps:77/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 PTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDK--------- 274
            |..|..|..|.   ...|..|..|...||              |..||......:|         
Zfish    49 PLHPHMHLPPK---LRRPFAPLTDSSTDE--------------TAGPRLLQTACEKLKITEASIV 96

  Fly   275 --SRNGAYTNSDSEDCSDDEGAQSRHEGGGMGG--------------KDSQGNGSSSNS------ 317
              ||.|:|    .|..|......:..||..:.|              |:|:....|:.|      
Zfish    97 NISRAGSY----QEHASCKNTPINEEEGADICGETNVTLKQEREAFLKNSEETSLSAGSDTEDGM 157

  Fly   318 ---KSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKW-KRVK 378
               |.||.||.|||.||.||||.|....|..:..|.::|..|.|:|.:|::||||||||| ||.|
Zfish   158 LKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREK 222

  Fly   379 AGLTSHGLGRNGTTSGTKIVVPIPVHV---NRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIGG 440
            .|:..|.|..:  .||.........|.   |.| |.:.|..::.   :.|.|..|....|:    
Zfish   223 VGVQPHTLSLH--YSGAPPAAQSLCHYLSGNPF-VPNPHPAIDS---AWPAPFQRLAQPAQ---- 277

  Fly   441 FEKFSGSTNASSPSGGPVGLGVGV 464
                    |:.||.|....||..:
Zfish   278 --------NSVSPPGFSALLGAAM 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/51 (53%)
arxbXP_002667096.1 Homeobox 166..218 CDD:278475 27/51 (53%)
OAR 351..368 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.