DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and enam

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001139215.1 Gene:enam / 100271749 XenbaseID:XB-GENE-6453554 Length:1071 Species:Xenopus tropicalis


Alignment Length:188 Identity:38/188 - (20%)
Similarity:64/188 - (34%) Gaps:54/188 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 LPSSPAGHPAAQQPQAQA-----QPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNP------- 162
            ||:.|...|....||:::     ||..|...||....:.|.|...| |......|:.|       
 Frog   111 LPAPPVQQPQLNPPQSKSNYVTKQPHQPLQLPPAPDQQAQAPMMFP-PFSNIMNPYQPYWQQPFM 174

  Fly   163 AAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSS 227
            ...|..|.       :...|.:|.....:..|..:.:.  .::||: .|..|:.:.|.       
 Frog   175 HGFGRPPN-------SNEGNGNYFGFFGMGGRAPYNSE--EINEDE-EPAKAEKESPK------- 222

  Fly   228 PAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDS 285
                 :.||:.           |.|..:.:|        |.:..:.:|:..|.||::|
 Frog   223 -----TESPVA-----------ETSNTTIAD--------NNSTTISQSQGNATTNNES 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475
enamNP_001139215.1 Amelin 2..>167 CDD:214832 16/56 (29%)
Enamelin 201..>281 CDD:292006 16/90 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.