DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxc3

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_002936696.1 Gene:hoxc3 / 100190990 XenbaseID:XB-GENE-5997986 Length:394 Species:Xenopus tropicalis


Alignment Length:236 Identity:67/236 - (28%)
Similarity:94/236 - (39%) Gaps:72/236 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 QANPGMAQL-----------QEP---TPPQAHSSPAKSGSHS-----------------PMEPAL 241
            |.|.||..|           |.|   .|..|:.|.:..|.||                 |..|..
 Frog    21 QGNNGMGYLGQQDYPSEDDYQPPFCLPPDTANGSASHKGEHSIKGIDFHLSEVSEQAQQPKSPNS 85

  Fly   242 DVGMDEDFECSGDSC----------SDISL-------TMSPRNYNGEMDKSRNGAYTNSDSEDCS 289
            |..:.:  ..|..||          ||::.       :..|:.....|.::|..:.....:...:
 Frog    86 DSPLPK--SASTQSCTSKKSTGPVSSDVTSPNKKSKGSNMPKQIFPWMKETRQNSKQKKQAPPPA 148

  Fly   290 DDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIAT 354
            ||..|.               :.|..:|.|:|.|||:|:.||:|||:|||..:||....|.::|.
 Frog   149 DDAPAV---------------DSSFLSSASKRARTAYTNSQLVELEKEFHFNRYLCRPRRLEMAK 198

  Fly   355 SLKLSEVQVKIWFQNRRAKWKRVKAGLTSH-GLGRNGTTSG 394
            .|.|||.|:||||||||.|:|:      .| |.|..|:..|
 Frog   199 LLNLSERQIKIWFQNRRMKFKK------DHKGKGGGGSPGG 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 29/50 (58%)
hoxc3XP_002936696.1 Homeobox 167..220 CDD:395001 30/52 (58%)
DUF4074 335..392 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.